PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA03G38180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 809aa    MW: 87420 Da    PI: 6.4796
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA03G38180.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26038.82.7e-1270575947101
           DUF260  47 kalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                      ++lp +er +a++s++ eA  r++dPvyG++gvi++lq q++ ++ ela +++++
  ONIVA03G38180.1 705 EQLPVQERGRAADSMAAEAYRRVQDPVYGCAGVINRLQDQIRAAQCELAWTHAQI 759
                      688999********************************************99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.630.101.2E-9263113No hitNo description
SuperFamilySSF531871.32E-6269107No hitNo description
SuperFamilySSF520253.27E-42114329No hitNo description
Gene3DG3DSA:3.50.30.301.0E-33147304No hitNo description
SuperFamilySSF531871.32E-62311570No hitNo description
Gene3DG3DSA:3.40.630.101.2E-92312574No hitNo description
CDDcd080224.99E-110325572No hitNo description
PfamPF043892.9E-15329537IPR007484Peptidase M28
SuperFamilySSF476722.62E-27571703IPR007365Transferrin receptor-like, dimerisation domain
Gene3DG3DSA:1.20.930.401.6E-16575705IPR007365Transferrin receptor-like, dimerisation domain
PfamPF042532.2E-19601702IPR007365Transferrin receptor-like, dimerisation domain
PfamPF031951.2E-9705755IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006508Biological Processproteolysis
GO:0009640Biological Processphotomorphogenesis
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0009910Biological Processnegative regulation of flower development
GO:0010080Biological Processregulation of floral meristem growth
GO:0010081Biological Processregulation of inflorescence meristem growth
GO:0010082Biological Processregulation of root meristem growth
GO:0010305Biological Processleaf vascular tissue pattern formation
GO:0004181Molecular Functionmetallocarboxypeptidase activity
Sequence ? help Back to Top
Protein Sequence    Length: 809 aa     Download sequence    Send to blast
MLSQPAAALA RLPPASVRVL VGFGAALLVS LVVLHRRPAA RGAAGGGGPA EYDPAARFLA  60
LSEGANATIA ADLRALTAGP HLAGTGAAAG AAARVLSGFR AAGLRTLTRE YTPLLSYPGH  120
ASLALLRADR TLLAHLSLDE PADVGRRLVR PYHAYAPSGG AVAEAVFVNL GREEDYLTLE  180
RLGVSVRGRV AVAIRGGGYR GGVVRRAAER SAAAVLIAGH ADGGVERGTV ILGGPGDPLT  240
PGWAATAGAE RLDFDHEDVK RRFPAIPSMP VSGKTASAII RTLGGPALPA DWQTGVGLPV  300
DVGGVGPGPT LVNFTYQEDR KMGMIQDIFA IIKGYEEPDR YVILGNHRDA WTYGAVDPNS  360
GTSALLDIAR RLGIMLQSGW TPRRTIILCS WDAEEFGMFS KISFICVPFI SFLHFEGSFF  420
QIGSTEWVEE NLEDLQSKAV AYLNVDCAVQ GIGLFAGSTP QLDNLLVDVT RQVKDPDVEG  480
KTVHDTWNKM TGGINIERLA RTDSDFAPFL HHAGIPCMDL YYGKEFPGYH TALDSYHWME  540
KHGDPLFLRH VAIVEIWGLL ALRLADDPVL PFDYQTYASQ LQEHANAFSS MMENSKWVHL  600
LNRSIEDLSD AGLEFLKEAK KLQDQNISDG YSLMRRRLLN DRLLLAERSF LQADGLQGRG  660
WFKHLMYSPP EDYESKLSFF PGVADAISRS SNRSAKEQQA AVRHEQLPVQ ERGRAADSMA  720
AEAYRRVQDP VYGCAGVINR LQDQIRAAQC ELAWTHAQIA MHSAAAAHAR TTLPPGQRDG  780
GGGGAPSTQQ ATTSAAWQLE DFASEFSFP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4w9y_A4e-976168719669Glutamate carboxypeptidase 2
4p4j_A4e-976168719669Glutamate carboxypeptidase 2
4p4i_A4e-976168719669Glutamate carboxypeptidase 2
4p4f_A4e-976168719669Glutamate carboxypeptidase 2
4p4e_A4e-976168719669Glutamate carboxypeptidase 2
4p4d_A4e-976168719669Glutamate carboxypeptidase 2
4p4b_A4e-976168719669Glutamate carboxypeptidase 2
4p45_A4e-976168719669Glutamate carboxypeptidase 2
4p44_A4e-976168719669Glutamate carboxypeptidase 2
4ome_A4e-976168719669Glutamate carboxypeptidase 2
2jbk_A4e-976168719669GLUTAMATE CARBOXYPEPTIDASE 2
2jbj_A4e-976168719669GLUTAMATE CARBOXYPEPTIDASE 2
2cij_A4e-976168719669GLUTAMATE CARBOXYPEPTIDASE II
2c6p_A4e-976168719669GLUTAMATE CARBOXYPEPTIDASE II
2c6g_A4e-976168719669GLUTAMATE CARBOXYPEPTIDASE II
2c6c_A4e-976168719669GLUTAMATE CARBOXYPEPTIDASE II
4oc5_A4e-976168721671Glutamate carboxypeptidase 2
4oc4_A4e-976168721671Glutamate carboxypeptidase 2
4oc3_A4e-976168721671Glutamate carboxypeptidase 2
4oc2_A4e-976168721671Glutamate carboxypeptidase 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4474030.0AB447403.1 Oryza sativa Japonica Group PLA3 mRNA for plastochron3, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627871.10.0PREDICTED: probable glutamate carboxypeptidase 2 isoform X1
SwissprotQ9M1S80.0GCP2_ARATH; Probable glutamate carboxypeptidase 2
TrEMBLA0A0E0P2C30.0A0A0E0P2C3_ORYRU; Uncharacterized protein
STRINGLOC_Os03g57660.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP803867
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.16e-11LOB domain-containing protein 24